Everything below concerns aggregation. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-04-04. Numbers and descriptions here follow the published literature rather than marketing material.
The compound binds the GLP-1 receptor on pancreatic beta cells and other tissues, activating a G-protein signaling cascade that raises intracellular cyclic AMP. This action increases glucose-dependent insulin secretion when blood glucose is elevated, while binding also slows gastric emptying and reduces glucagon release. In the central nervous system, receptor activation in the hypothalamus and brainstem contributes to reduced appetite. The fatty acid chain binds albumin, which protects the peptide from renal filtration and enzymatic degradation. This albumin binding is central to its extended circulation time.
Native GLP-1 is degraded rapidly by dipeptidyl peptidase-4. Semaglutide resists this cleavage because alanine at position 8 is replaced by alpha-aminoisobutyric acid. A second substitution at position 34 introduces arginine, which further stabilizes the peptide. The most distinctive modification is a spacer and C18 fatty diacid attached at lysine 26, enabling strong albumin affinity. These three changes together produce a half-life measured in days rather than minutes, and the same structural logic underlies other long-acting analogs in this class.
Semaglutide is a synthetic peptide analog of glucagon-like peptide-1, a hormone released from intestinal L-cells after food intake. It contains 31 amino acids and differs from native GLP-1 through modifications that slow enzymatic breakdown. The peptide was developed to extend the short circulating half-life of endogenous GLP-1, which is measured in minutes. Researchers introduced the compound in the early 2010s. Two backbone changes and a fatty acid side chain define its structure, distinguishing it from earlier GLP-1 receptor agonists.
Lyophilised semaglutide is generally held at -20 °C or below, protected from light and moisture. Reconstituted solutions are typically kept at 2-8 °C and used within a defined window because degradation accumulates over time. Repeated freeze-thaw cycles are discouraged, since each cycle can promote aggregation and reduce monomeric content. Room-temperature stability of the solid has been examined in some studies but remains incompletely characterised for long durations, so cold storage is the conservative default for research material.
Degradation proceeds along several parallel routes. Deamidation of asparagine and glutamine residues generates charged variants that shift retention time in chromatographic analysis. Oxidation targets methionine and can be accelerated by trace metals or dissolved oxygen. Non-covalent aggregation produces dimers, oligomers, and larger species that are difficult to reverse. Isomerisation at aspartate residues is slower but measurable under thermal stress. The distribution among these pathways depends on pH, buffer composition, ionic strength, and the presence of excipients such as sugars or surfactants.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | 31 amino acids |
| Backbone modification | Aib at position 8 | Blocks DPP-4 cleavage |
| Fatty acid chain | C18 diacid | Supports albumin binding |
| Native half-life | 1 to 2 minutes | Endogenous GLP-1 |
| Analog half-life | Approximately one week | Extended by albumin binding |
Peptides are sensitive to temperature, light, oxygen, and repeated freeze-thaw cycles. Semaglutide in dry form is generally held at refrigerated temperatures, while reconstituted solutions require a defined short-term storage window. Vials should be kept in secondary packaging to limit photodegradation, and exposure to alkaline conditions is avoided because it accelerates chemical degradation. Adsorption to glass and some plastics can reduce the measured concentration of dilute solutions, so low-binding polypropylene containers are preferred for analytical work. Each transfer step introduces a small risk of contamination, and closed handling practices reduce that risk.
Routine characterisation of the peptide relies on reversed-phase high-performance liquid chromatography, often paired with ultraviolet detection near 214 nanometres. Related substances such as deamidated, oxidised, and truncated sequences elute at characteristic positions and are quantified by area percentage. Electrospray ionisation mass spectrometry confirms the molecular mass and can resolve some closely related variants. Peptide mapping after enzymatic digestion provides sequence-level verification and is useful when a full identity profile is required. Method parameters such as column chemistry, gradient, and mobile-phase pH influence the separation and must be reported alongside results.
Material described as research-grade is not necessarily manufactured to pharmaceutical standards, and purity figures depend on the method used to obtain them. A certificate of analysis states the measured purity, the analytical technique, and the batch identifier, but the underlying data are not always included. Independent testing by a second laboratory is a common way to confirm identity and purity. Uncertainties remain about how storage history affects long-term stability, and about how well results from one laboratory transfer to another. Documentation of handling conditions supports comparison between batches.
Semaglutide is a synthetic peptide analog of human glucagon-like peptide-1, developed by Novo Nordisk and first approved in 2017 for type 2 diabetes. It belongs to the incretin mimetic class, a group of agents that reproduce the glucose-dependent actions of endogenous GLP-1. The molecule was engineered to resist degradation by dipeptidyl peptidase-4 and to bind serum albumin, extending its half-life from minutes to roughly one week. Approval for chronic weight management followed in 2021, based on large cardiovascular and obesity outcome trials.
GLP-1 receptors are expressed on pancreatic beta cells, in the gut, and in several brain regions. Receptor activation raises cyclic AMP, enhances glucose-dependent insulin secretion, and suppresses glucagon release when blood glucose is high. Effects on gastric emptying and on hypothalamic appetite circuits reduce energy intake. Because insulin release remains glucose-dependent, the risk of hypoglycemia is low when the drug is used alone. The precise contribution of each pathway to body weight change in humans remains an area of active investigation.
Lyophilized peptide material is typically stored at or below -20 °C, with -80 °C used for longer-term archives. Vials should remain sealed and desiccated because moisture promotes aggregation and hydrolysis. Repeated freeze-thaw cycles are avoided since they can alter peptide conformation and reduce recovery. Once reconstituted, solutions are generally kept at 2-8 °C and used within a defined window. Stability beyond those windows depends on buffer composition and concentration, and exact limits are product-specific rather than universal.
Identity and purity are assessed with reversed-phase high-performance liquid chromatography, which separates the peptide from related impurities by hydrophobicity. Mass spectrometry confirms molecular weight and detects truncation or modification products. Peptide mapping after enzymatic digestion verifies the amino acid sequence. Quantitation is often performed by LC-MS/MS or by immunoassay, and the two approaches can give different values because they measure different things. Method validation parameters such as accuracy, precision, and limit of quantitation are reported alongside results.
Peptide degradation follows several routes. Hydrolysis cleaves the backbone at susceptible residues, oxidation targets methionine and tryptophan side chains, and aggregation produces higher-molecular-weight species that are difficult to reverse. Light exposure accelerates oxidation, which is why amber glass or opaque secondary packaging is common. Repeated freeze-thaw cycles promote aggregation and are best avoided. Stability-indicating methods detect these changes before they become visible.
Quality control for research material typically involves reversed-phase HPLC for purity and identity, mass spectrometry for molecular weight confirmation, and Karl Fischer titration for residual water content. Peptide content is often reported as the mass of actual peptide rather than total powder mass, since counterions and water contribute to the latter. A certificate of analysis should list the method used for each specification. Limits and acceptance criteria vary by supplier and by intended application.
White House National Security Advisor Jake Sullivan responded to the report saying there was still "no definitive answer" to the question of the pandemic's origins. On 28 February 2023, the head of the Federal Bureau of Investigation (FBI), Christopher Wray, said the bureau believes Covid-19 most likely originated in the lab. The FBI concluded with "moderate confidence" that COVID-19 may have been created in a laboratory, based in part on genomic analysis conducted by scientists at the National Center for Medical Intelligence. On 20 March 2023, the COVID-19 Origin Act of 2023 was signed into law. On 23 June 2023, the Biden administration released its report, as required by the Act.
=== Brazil === The R2 Combat Operation Ration (Portuguese: Ração Operacional de Combate – R2) is the current field & combat ration for the Brazilian Army. It is based on the earlier, but similar, Alternative Combat Ration for 24 Hours (Portuguese: Ração Alternativa de Combate, 24 horas) developed by the Brazilian Navy for use by Naval Infantry units. It contains the food and supplemental items needed by 1 soldier for 24 hours. It is to be used in situations where no other type of ration is available. All foods are packed inside 4-ply plastic and aluminum polylaminate retort pouches and are ready to eat without further preparation. The ration is packed inside a heavy-duty (.25 mm thick) matte green or olive drab polyethylene bag measuring 300 mm wide by 400 mm long. It is printed with the logo of the Brazilian Army, the name of the ration, and menu information. Inside are 5 thinner (.10 mm) semi-transparent plastic bags, one for each meal and one for the accessories. Each bag is printed with meal information and contents.
Age-related macular degeneration (AMD) represents the leading cause of irreversible blindness in elderly people. AMD is an oxidative stress, retinal disease that affects the macula, causing progressive loss of central vision. β-carotene content is confirmed in human retinal pigment epithelium. Reviews reported mixed results for observational studies, with some reporting that diets higher in β-carotene correlated with a decreased risk of AMD whereas other studies reporting no benefits. Reviews reported that for intervention trials using only β-carotene, there was no change to risk of developing AMD.
Sources: en.wikipedia.org
Refrigerator cars required effective insulation to protect their contents from temperature extremes. "Hairfelt" derived from compressed cattle hair, sandwiched into the floor and walls of the car, was inexpensive, yet flawed over its three- to four-year service life, it would decay, rotting out the car's wooden partitions and tainting the cargo with a foul odor. The higher cost of other materials, such as "Linofelt" (woven from flax fibers) or cork, prevented their widespread adoption. Synthetic materials such as fiberglass and polystyrene foam, both introduced after World War II, offered the most cost-effective and practical solution. The United States Office of Defense Transportation implemented mandatory pooling of class RS produce refrigerator cars from 1941 through 1948. World War II experience found the cars spending 60 percent of their time traveling loaded, 30 percent traveling empty, and 10 percent idle; and indicated the average 14 loads each car carried per year included 5 requiring bunker icing, 1 requiring heating, and 8 using ventilation or top icing.
Polycrystalline graphene was generated from these nucleation sites and was subsequently annealed at 3000K, and then quenched. Based on this model, they found that cracks are initiated at grain-boundary junctions, but the grain size does not significantly affect the strength. Second, in 2013, Z. Song et al. used MD simulations to study the mechanical properties of polycrystalline graphene with uniform-sized hexagon-shaped grains. The hexagon grains were oriented in various lattice directions and the GBs consisted of only heptagon, pentagon, and hexagonal carbon rings. The motivation behind such a model was that similar systems had been experimentally observed in graphene flakes grown on the surface of liquid copper. While they also noted that crack is typically initiated at the triple junctions, they found that as the grain size decreases, the yield strength of graphene increases. Based on this finding, they proposed that polycrystalline follows pseudo Hall-Petch relationship. Third, in 2013, Z. D. Sha et al. studied the effect of grain size on the properties of polycrystalline graphene, by modeling the grain patches using Voronoi construction. The GBs in this model consisted of heptagons, pentagons, and hexagons, as well as squares, octagons, and vacancies. Through MD simulation, contrary to the aforementioned study, they found an inverse Hall-Petch relationship, where the strength of graphene increases as the grain size increases. Experimental observations and other theoretical predictions also gave differing conclusions, similar to the three given above.
Picrorhiza kurroa is one of the major income generating non-timber forest products found in the Nepalese Himalayas. It is one of the oldest medicinal plants traded from the Karnali zone. Known as kutki or कुटकी in Nepali, it is a perennial herb and is used as a substitute for Indian gentian (Gentiana kurroo).
Sources: en.wikipedia.org
=== Cytokines in differentiation === Activated naive CD4+ T cells differentiate into Th22 cells under the influence of interleukin-6 (IL-6) and tumor necrosis factor alpha (TNF-alpha). This process can be inhibited by the addition of increasing concentrations of transforming growth factor beta (TGF-beta). The combination of interleukin-21 (IL-21) and interleukin-23 (IL-23) can also induce the differentiation of naive T cells into Th22 cells via the endogenous toll-like receptor 4 ligand (TLR4), stimulating keratinocytes to secrete interleukin-23 (IL-23) and binds to the IL-23 receptor of skin dendritic cells. This mechanism induces the differentiation into Th22 cells and secretion of interleukin-22 (IL−22).
Vitamin B17: pseudoscientific name for the poisonous compound amygdalin, also known as "laetrile" or by the equally pseudoscientific name "nitrilosides" despite the fact that it is a single compound. Amygdalin can be found in various plants, but is most commonly extracted from apricot pits and other similar fruit kernels. Amygdalin is hydrolyzed by various intestinal enzymes to form, among other things, hydrogen cyanide, which is toxic to human beings when exposed to a high enough dosage. Some proponents claim that amygdalin is effective in cancer treatment and prevention, despite its toxicity and a lack of scientific evidence. Vitamin B20: L-carnitine. Vitamin Bf: carnitine. Vitamin Bm: myo-inositol, also called "mouse antialopaecia factor". Vitamin Bp: "antiperosis factor", which prevents perosis, a leg disorder, in chicks; can be replaced by choline and manganese salts. Vitamin BT: carnitine. Vitamin Bv: a type of B6 other than pyridoxine. Vitamin BW: a type of biotin other than d-biotin. Vitamin Bx: an alternative name for both pABA (see vitamin B10) and pantothenic acid.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
Sources: en.wikipedia.org
It is a synthetic analog of GLP-1 produced through medicinal chemistry to resist enzymatic degradation. The design goal was longer circulation than the native hormone.
A fatty acid side chain attaches the peptide to serum albumin, which shields it from kidney filtration and protease activity. This interaction is the main reason its circulation time is extended.
No. The native hormone is GLP-1, and semaglutide is an engineered variant with three deliberate structural alterations. It does not appear in unmodified biological sources.
Reverse-phase high-performance liquid chromatography with ultraviolet detection is the usual choice, with results reported as area percent. Complementary methods such as size-exclusion chromatography and mass spectrometry are needed because a single separation cannot resolve every impurity class. Purity figures are therefore method dependent and should always be read alongside the technique used.