If you have been reading about fatty diacid and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-02-11. Numbers and descriptions here follow the published literature rather than marketing material.
Semaglutide is a synthetic peptide of thirty-one amino acids that shares roughly ninety-four percent sequence identity with human glucagon-like peptide-1. Two substitutions resist enzymatic cleavage by dipeptidyl peptidase-4, and a fatty diacid side chain attached through a linker promotes binding to serum albumin. That albumin binding slows renal clearance and extends the circulating half-life from minutes to approximately one week. The structural changes are well established in the published literature. Whether the same modifications affect receptor signalling bias in ways that matter clinically remains an open question.
Pharmacological activity arises from agonism at the glucagon-like peptide-1 receptor, a G protein-coupled receptor expressed in the pancreas, the gastrointestinal tract, and the brainstem. Receptor activation raises intracellular cyclic adenosine monophosphate and enhances insulin release in a glucose-dependent manner, an effect that diminishes when blood glucose concentration is low. Other effects include slowed gastric emptying and hypothalamic satiety signalling. These pathways are described well. Receptor desensitisation rates across tissues, relative to the endogenous hormone, are still under investigation, and reported findings differ between laboratories.
The company that developed the compound filed it as a long-acting analogue, and it gained first approval in 2017 for type 2 diabetes. Later authorisations from several regulators extended the indication to chronic weight management, and the World Health Organization added the glucagon-like peptide-1 receptor agonist drug class to its model list of essential medicines in 2023. Production uses solid-phase peptide synthesis followed by side-chain conjugation and chromatographic purification. Supply constraints and cost differences across regions are well documented. Literature on long-term outcomes continues to grow, with many trials reporting surrogate endpoints rather than hard clinical endpoints.
Receptor activation occurs at GLP-1 receptors distributed across pancreatic islets, the hypothalamus, and the gastrointestinal tract. Binding triggers G protein signaling that raises cyclic AMP and enhances glucose-dependent insulin release. Because the effect depends on prevailing glucose levels, insulin secretion does not rise when blood sugar is already low. Signaling in the brain and gut also influences appetite and gastric emptying, which is why the compound appears in both metabolic and weight-related research literature.
Development began in the early 2010s with the goal of extending GLP-1 activity beyond the brief window achieved by native peptide infusion. The earliest approved formulation was a subcutaneous injection given once weekly. A later oral tablet pairs the peptide with an absorption enhancer, sodium N-(8-[2-hydroxybenzoyl] amino) caprylate, usually shortened to SNAC. That carrier lowers local pH and helps the peptide cross gastric tissue. Both routes deliver the same active molecule.
| Property | Value | Notes |
|---|---|---|
| Molecular class | 31-amino-acid peptide | Modified glucagon-like peptide-1 analogue |
| Molecular mass | approximately 4114 Da | Calculated for the free peptide backbone |
| Appearance | white to off-white powder | Typical of purified lyophilised peptide batches |
| Solubility class | freely soluble in water | Aqueous solubility improves at slightly alkaline pH |
| Typical storage | -20 degrees Celsius, dry, dark | Protect from repeated freeze-thaw cycles |
Semaglutide is a synthetic peptide that acts as an agonist at the glucagon-like peptide-1 receptor. It is a structural analogue of human GLP-1(7-37), modified to resist enzymatic degradation by dipeptidyl peptidase-4. The peptide backbone contains alpha-aminoisobutyric acid at position 8, a substitution that stabilises the helix and slows cleavage. A fatty diacid side chain attached through a linker at lysine 34 promotes binding to serum albumin, which extends the circulating half-life. These two modifications together allow less frequent administration than native GLP-1 requires.
Activation of the GLP-1 receptor couples to Gs signalling and raises intracellular cyclic AMP in pancreatic beta cells. The resulting insulin release depends on prevailing glucose concentrations, so the effect is greater when glucose is elevated. Receptor engagement also suppresses glucagon secretion and slows gastric emptying, which flattens post-meal glucose excursions. In the central nervous system, signalling in hypothalamic and brainstem regions is associated with reduced appetite and lower energy intake. Studies continue to examine effects on cardiac, renal and hepatic endpoints; whether those benefits are independent of weight change remains an open question.
Clinical development of this compound followed earlier short-acting GLP-1 analogues that required frequent injection. Once-weekly subcutaneous formulations entered use after 2017, and an oral formulation using a permeation enhancer later became available. The oral version pairs the peptide with sodium N-(8-[2-hydroxybenzoyl] amino) caprylate, a carrier that improves uptake across the gastric epithelium. Interest has expanded from glycaemic control into weight management and metabolic liver disease. Regulatory status and approved indications differ between countries, and the product remains subject to ongoing safety monitoring.
As a peptide, semaglutide is sensitive to conditions that break amide bonds or modify side chains. Deamidation of asparagine and glutamine residues, oxidation of methionine and tryptophan, and non-covalent aggregation are the main degradation routes described in published stability work. Rate depends strongly on pH, buffer species, ionic strength, temperature and exposure to light. Formulators therefore choose a defined solution pH and often add excipients such as phosphate buffer, propylene glycol and phenol, each of which plays a separate role in pH control, tonicity or preservation.
Storage guidance for the finished injectable product distinguishes the unused state from the in-use state. Before first use, pens are kept refrigerated between 2 and 8 degrees Celsius, protected from light, and never frozen, since freezing can disrupt the peptide or the device. After first use, label instructions in several markets permit storage at room temperature up to about 30 degrees Celsius for a limited number of days. Solid research-grade material is normally held at or below minus 20 degrees Celsius, often with desiccant, and allowed to equilibrate before opening.
Quantification and purity assessment rely on separation methods coupled to optical or mass detection. Reversed-phase high-performance liquid chromatography resolves the intact peptide from related impurities and is the standard assay technique. Size-exclusion chromatography measures aggregates, while ion-exchange chromatography separates charge variants produced by deamidation. Mass spectrometry confirms identity and detects mass shifts of a few daltons. In biological matrices, liquid chromatography with tandem mass spectrometry is often used because immunoassays can cross-react with endogenous GLP-1 or with circulating fragments.
Lyophilised material appears as a white to off-white cake or powder that is hygroscopic, and containers are usually equilibrated to room temperature before opening to limit condensation. Dissolution is performed in water, phosphate-buffered saline, or a mildly alkaline buffer, since solubility rises above neutral pH. Gentle inversion or low-speed mixing is preferred, because vigorous vortexing can promote surface denaturation and aggregation. Complete dissolution may require several minutes, and brief sonication is sometimes applied. Passing the solution through a 0.22 micrometre membrane removes particulates but does not by itself sterilise the liquid.
Storage at minus 20 degrees Celsius or lower in a desiccated container preserves the peptide for extended periods, while working solutions are commonly held at two to eight degrees Celsius for short intervals. Light exposure and repeated freeze-thaw cycles accelerate degradation, so dividing material into single-use aliquots is generally recommended. Adsorption to glass and plastic surfaces can lower the measured concentration of dilute solutions, particularly below one milligram per millilitre. The degradation routes most often reported for GLP-1 analogues are deamidation, methionine oxidation, and backbone hydrolysis. Relative rates under specific conditions are frequently described only for individual formulations.
=== Domestic use === When a sanitary potable water supply is plumbed to an unsanitary system, for example lawn sprinklers, a dish washer or a washing machine, a check valve called a backflow preventer is used to prevent contaminated water from re-entering the domestic water supply. Some types of irrigation sprinklers and drip irrigation emitters have small check valves built into them to keep the lines from draining when the system is shut off. Check valves used in domestic heating systems to prevent vertical convection, especially in combination with solar thermal installations, also are called gravity brakes. Rainwater harvesting systems that are plumbed into the main water supply of a utility provider may be required to have one or more check valves fitted to prevent contamination of the primary supply by rainwater. Hydraulic jacks use ball check valves to build pressure on the lifting side of the jack. Check valves are commonly used in inflatables, such as toys, mattresses and boats. This allows the object to be inflated without continuous or uninterrupted air pressure.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== External links == "Tacrolimus Injection". MedlinePlus. "Tacrolimus Topical". MedlinePlus. Tacrolimus at the U.S. National Library of Medicine Medical Subject Headings (MeSH) "FDA Approves New Use of Transplant Drug Based on Real-World Evidence". U.S. Food and Drug Administration (FDA). 30 September 2021. Archived from the original on 16 July 2021.
=== 1988 === February 20: The First Nagorno-Karabakh War was fought between Armenia and Azerbaijan. February 22: USS Yorktown and USS Caron are rammed off the Crimean Peninsula after entering Soviet territorial waters. May 11: Kim Philby (Harold Adrian Russell Philby), the high-ranking UK intelligence officer who defected to the Soviet Union, dies in Moscow. May 15: The Soviets begin withdrawing from Afghanistan. May 29–June 1: Reagan and Gorbachev meet in Moscow. INF Treaty ratified. When asked if he still believes that the Soviet Union is still an evil empire, Reagan replies he was talking about "another time, another era". October 5: Chile's Augusto Pinochet loses a national plebiscite on his rule. November 3: A coup attempt occurred in the Maldives. November 6: Soviet scientist and well-known human rights activist Andrei Sakharov begins a two-week visit to the United States. November 15: The State of Palestine was formally established through the Palestinian Declaration of Independence. December 7: Gorbachev announces in a speech to the United Nations General Assembly that the Soviet Union will no longer militarily interfere with Eastern Europe.
Sources: en.wikipedia.org
EC 2.4.2.24: 1,4-β-D-xylan synthase EC 2.4.2.25: flavone apiosyltransferase EC 2.4.2.26: protein xylosyltransferase EC 2.4.2.27: dTDP-dihydrostreptose—streptidine-6-phosphate dihydrostreptosyltransferase EC 2.4.2.28: S-methyl-5′-thioadenosine phosphorylase EC 2.4.2.29: tRNA-guanosine34 preQ1 transglycosylase EC 2.4.2.30: NAD+ ADP-ribosyltransferase EC 2.4.2.31: NAD+—protein-arginine ADP-ribosyltransferase EC 2.4.2.32: dolichyl-phosphate D-xylosyltransferase EC 2.4.2.33: dolichyl-xylosyl-phosphate—protein xylosyltransferase EC 2.4.2.34: indolylacetylinositol arabinosyltransferase EC 2.4.2.35: flavonol-3-O-glycoside xylosyltransferase EC 2.4.2.36: NAD+—diphthamide ADP-ribosyltransferase EC 2.4.2.37: NAD+ —dinitrogen-reductase ADP-D-ribosyltransferase EC 2.4.2.38: glycoprotein 2-β-D-xylosyltransferase EC 2.4.2.39: xyloglucan 6-xylosyltransferase EC 2.4.2.40: zeatin O-β-D-xylosyltransferase EC 2.4.2.41: xylogalacturonan β-1,3-xylosyltransferase EC 2.4.2.42: UDP-D-xylose:β-D-glucoside α-1,3-D-xylosyltransferase EC 2.4.2.43: lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase EC 2.4.2.44: S-methyl-5′-thioinosine phosphorylase EC 2.4.2.45: decaprenyl-phosphate phosphoribosyltransferase EC 2.4.2.46: galactan 5-O-arabinofuranosyltransferase EC 2.4.2.47: arabinofuranan 3-O-arabinosyltransferase EC 2.4.2.48: tRNA-guanine15 transglycosylase EC 2.4.2.49: neamine phosphoribosyltransferase EC 2.4.2.50: cyanidin 3-O-galactoside 2′′-O-xylosyltransferase EC 2.4.2.51: anthocyanidin 3-O-glucoside 2′′′-O-xylosyltransferase EC 2.4.2.52: triphosphoribosyl-dephospho-CoA synthase EC 2.4.2.53: undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase EC 2.4.2.54: β-ribofuranosylphenol 5′-phosphate synthase EC 2.4.2.55: nicotinate D-ribonucleotide:phenol phospho-D-ribosyltransferase EC 2.4.2.56: kaempferol 3-O-xylosyltransferase EC 2.4.2.57: AMP phosphorylase EC 2.4.2.58: hydroxyproline O-arabinosyltransferase EC 2.4.2.59: sulfide-dependent adenosine diphosphate thiazole synthase EC 2.4.2.60: cysteine-dependent adenosine diphosphate thiazole synthase EC 2.4.2.61: α-dystroglycan β1,4-xylosyltransferase EC 2.4.2.62: xylosyl α-1,3-xylosyltransferase EC 2.4.2.63: EGF-domain serine xylosyltransferase EC 2.4.2.64: tRNA-guanosine34 queuine transglycosylase
=== Early days of Pentagram === Though Pentagram struggled with lineup changes and financial issues, the band became a key influence in the development of doom metal, with Liebling's distinct vocals and songwriting playing a major role in their cult following. Their early recordings, particularly Relentless (1985) and Day of Reckoning (1987), laid the groundwork for future doom metal acts. Despite their potential, Liebling's struggles with substance abuse, internal conflicts, and frequent lineup changes prevented Pentagram from achieving stability and mainstream success. By the mid-1970s, the band had caught the attention of influential managers and producers. One such figure was Gordon Fletcher, a columnist for Rolling Stone and Creem, who connected them with Sandy Pearlman and Murray Krugman, producers and managers of Blue Öyster Cult. Pentagram had an opportunity to record a full album, but the deal collapsed when Liebling, dissatisfied with the production of one of his tracks, had a heated argument with Krugman. As a result, Krugman walked out, canceling their contract. Gene Simmons and Paul Stanley of Kiss were invited to a Pentagram rehearsal, with hopes of impressing them and securing their mentorship. However, guitarist Vince McAllister and bassist Greg Mayne, who at the time were janitors, arrived late, still in their dirty uniforms from work. The Kiss members mocked their appearance rather than taking the band seriously. Despite this, Paul Stanley offered to purchase some of their songs, but Liebling refused, wanting to keep control of his material.
=== Uniqueness of venom === Centipede venom generally contains a few different enzymes that are very different from other arthropods, where metalloprotease, an enzyme that breaks down protein plays an important role. Centipede venom has effects on skeletal muscles, heart muscles, and neurons, and the effects are attributed to the larger protein molecules in the venom. Venoms of S. mutilans contain a diverse range of neurotoxins, including 26 neurotoxin-like peptides that belong to 10 different groups. Most of the 26 identified neurotoxin-like peptides have a different molecular structure compared to the neurotoxins found in spiders, snakes, scorpions, marine cone snails, and sea anemones. The functional mechanism of these peptides are similar to the neurotoxins of the mention venomous animals, yet their primary structures remain unique. A few were found to contain insecticidal properties and act on voltage-gated sodium, potassium, and calcium channels. It was found that both purified neurotoxins and unprocessed centipede venom are highly insecticidal, with the unprocessed venom being significantly stronger than all purified neurotoxins in insecticidal effects. Centipede venoms might have the potential to provide peptide candidates with potential pharmaceutical or agrochemical uses due to their high level of biochemical diversity.
Sources: en.wikipedia.org
It is a glucagon-like peptide-1 receptor agonist, often grouped with the incretin mimetics. Its backbone is modified from the human hormone to resist enzymatic degradation and to bind albumin. These two features distinguish it from the native peptide.
No. It shares high sequence identity but carries non-natural modifications that alter its stability and clearance. The naturally occurring hormone is broken down within minutes, while the synthetic analogue circulates far longer.
Attachment to serum albumin reduces renal filtration of the peptide and shields it from enzymatic breakdown. The consequence is a much longer interval between administrations than unmodified peptides allow. The precise contribution of binding affinity to overall duration is still being quantified.
Native GLP-1 is degraded within minutes by circulating enzymes. The synthetic version carries substitutions at positions that block enzymatic cleavage, plus a fatty acid side chain that promotes albumin binding. These two changes together extend circulation time from minutes to roughly a week.